Product Description
Recombinant Rana japonica Sialic acid-binding lectin is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names :
Expression Region : 1-111aa
AA Sequence : QNWAKFQEKHIPNTSNINCNTIMDKSIYIVGGQCKERNTFIISSATTVKAICSGASTNRNVLSTTRFQLNTCIRSATAPRPCPYNSRTETNVICVKCENRLPVHFAGIGRC
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 16.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : The S-lectins in frog eggs may be involved in the fertilization and development of the frog bryo. This lectin preferentially agglutinate a large variety of tumor cells, but it does not agglutinate non-transformed cells and erythrocytes.
Function : The S-lectins in frog eggs may be involved in the fertilization and development of the frog embryo. This lectin preferentially agglutinate a large variety of tumor cells, but it does not agglutinate non-transformed cells and erythrocytes.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Pancreatic ribonuclease family
Tissue Specificity :
Paythway :
Uniprot ID : P18839
Euro
British Pound
US Dollar