Product Description
Recombinant Rat Fatty acid-binding protein, heart (Fabp3) is available at Gentaur for Next week Delivery.
Gene Name: FABP3
Alternative Names : Fatty acid-binding protein 3 Heart-type fatty acid-binding protein Short name: H-FABP
Expression Region : 2-133aa
AA Sequence : ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 18.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Function : FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Calycin superfamily, Fatty-acid binding protein (FABP) family
Tissue Specificity : Heart, but also skeletal muscle, kidney, brain and mammary gland.
Paythway :
Uniprot ID : P07483
Euro
British Pound
US Dollar