Recombinant Rat Fatty acid-binding protein, heart (Fabp3)

Product Description

Recombinant Rat Fatty acid-binding protein, heart (Fabp3) is available at Gentaur for Next week Delivery.

Gene Name: FABP3

Alternative Names : Fatty acid-binding protein 3 Heart-type fatty acid-binding protein Short name: H-FABP

Expression Region : 2-133aa

AA Sequence : ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 18.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

Function : FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Calycin superfamily, Fatty-acid binding protein (FABP) family

Tissue Specificity : Heart, but also skeletal muscle, kidney, brain and mammary gland.

Paythway :

Uniprot ID : P07483