Recombinant Rat GTPase HRas (Hras)

Product Description

Recombinant Rat GTPase HRas (Hras) is available at Gentaur for Next week Delivery.

Gene Name: Hras

Alternative Names : H-Ras-1Transforming protein p21c-H-rasp21ras

Expression Region : 2-186aa

AA Sequence : TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 24.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.

Function : Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.

Involvement in disease :

Subcellular location : Cell membrane, Cell membrane, Lipid-anchor, Cytoplasmic side, Golgi apparatus, Golgi apparatus membrane, Lipid-anchor

Protein Families : Small GTPase superfamily, Ras family

Tissue Specificity :

Paythway :

Uniprot ID : P20171