Recombinant Rat Lutropin-choriogonadotropic hormone receptor (Lhcgr)

Product Description

Recombinant Rat Lutropin-choriogonadotropic hormone receptor (Lhcgr) is available at Gentaur for Next week Delivery.

Gene Name: Lhcgr

Alternative Names : Luteinizing hormone receptor Short name: LSH-R

Expression Region : 27-362aa

AA Sequence : RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMG

Sequence Info : Full Length of Mature Protein

Tag Info : C-terminal Flag-tagged

Theoretical MW : 47.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.

Function : Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein, Secreted

Protein Families : G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily

Tissue Specificity :

Paythway :

Uniprot ID : P16235