Recombinant Rat Osteocalcin (Bglap)

Product Description

Recombinant Rat Osteocalcin (Bglap) is available at Gentaur for Next week Delivery.

Gene Name: Bglap

Alternative Names : Bone Gla protein;BGPGamma-carboxyglutamic acid-containing protein

Expression Region : 50-99aa

AA Sequence : YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal GST-tagged

Theoretical MW : 32.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Function : Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Osteocalcin/matrix Gla protein family

Tissue Specificity :

Paythway :

Uniprot ID : P04640