Product Description
Recombinant Rat Peripheral myelin protein 22 (Pmp22) is available at Gentaur for Next week Delivery.
Gene Name: Pmp22
Alternative Names : Protein CD25 (SR13 myelin protein) (Schwann cell membrane glycoprotein) (SAG) (Cd25) (Pmp-22)
Expression Region : 1-160aa
AA Sequence : MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE
Sequence Info : Full Length
Tag Info : N-terminal 10xHis-tagged
Theoretical MW : 23.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Might be involved in growth regulation, and in myelinization in the peripheral nervous system.
Function : Might be involved in growth regulation, and in myelinization in the peripheral nervous system.
Involvement in disease :
Subcellular location : Cell membrane, Multi-pass membrane protein
Protein Families : PMP-22/EMP/MP20 family
Tissue Specificity : Found exclusively in the peripheral nervous system. Present in both myelinating and nonmyelinating Schwann cells. Found in the tumors of Schwann cell lineage where axons are present (neurofibromas) but not where axons are absent (schwannomas).
Paythway :
Uniprot ID : P25094
Euro
British Pound
US Dollar