Recombinant Rat Peripheral myelin protein 22 (Pmp22)

Product Description

Recombinant Rat Peripheral myelin protein 22 (Pmp22) is available at Gentaur for Next week Delivery.

Gene Name: Pmp22

Alternative Names : Protein CD25 (SR13 myelin protein) (Schwann cell membrane glycoprotein) (SAG) (Cd25) (Pmp-22)

Expression Region : 1-160aa

AA Sequence : MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged

Theoretical MW : 23.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Might be involved in growth regulation, and in myelinization in the peripheral nervous system.

Function : Might be involved in growth regulation, and in myelinization in the peripheral nervous system.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : PMP-22/EMP/MP20 family

Tissue Specificity : Found exclusively in the peripheral nervous system. Present in both myelinating and nonmyelinating Schwann cells. Found in the tumors of Schwann cell lineage where axons are present (neurofibromas) but not where axons are absent (schwannomas).

Paythway :

Uniprot ID : P25094