Product Description
Recombinant Rat Ribosyldihydronicotinamide dehydrogenase (Nqo2) is available at Gentaur for Next week Delivery.
Gene Name: Nqo2
Alternative Names : NRH dehydrogenase [quinone] 2NRH:quinone oxidoreductase 2Quinone reductase 2;QR2
Expression Region : 1-231aa
AA Sequence : MAGKKVLLVYAHQEPKSFNGSMKQVAVEELSKQGCTVTVSDLYTMNFEPRATRNDVTGALSNPEVFKYGIEAYEAYKKKALTSDILEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDVPGFYDSGFLKDKLALLSFTTGGTAEMYTKAGVNGDFRYFLWPLQHGTLHFCGFKVLAPQISFGPEVSSEEQRKVMLASWVQRLKSIWKEEPIHCTPSWYFQG
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 28.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.
Function : The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : NAD(P)H dehydrogenase (quinone) family
Tissue Specificity :
Paythway :
Uniprot ID : Q6AY80
Euro
British Pound
US Dollar