Recombinant Rat Sclerostin (Sost)

Product Description

Recombinant Rat Sclerostin (Sost) is available at Gentaur for Next week Delivery.

Gene Name: Sost

Alternative Names :

Expression Region : 29-213aa

AA Sequence : FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 28.0 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Stem Cells

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.

Function : Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Sclerostin family

Tissue Specificity :

Paythway :

Uniprot ID : Q99P67