Recombinant Rat Type II iodothyronine deiodinase (Dio2)

Product Description

Recombinant Rat Type II iodothyronine deiodinase (Dio2) is available at Gentaur for Next week Delivery.

Gene Name: Dio2

Alternative Names : 5DIIDIOIIType 2 DIType-II 5'-deiodinase

Expression Region : 1-266aa

AA Sequence : MGLLSVDLLITLQILPVFFSNCLFLALYDSVILLKHVALLLSRSKSTRGEWRRMLTSEGLRCVWNSFLLDAYKQVKLGEDAPNSSVVHVSNPEAGNNCASEKTADGAECHLLDFASAERPLVVNFGSATUPPFTRQLPAFRQLVEEFSSVADFLLVYIDEAHPSDGWAVPGDSSMSFEVKKHRNQEDRCAAAHQLLERFSLPPQCQVVADRMDNNANVAYGVAFERVCIVQRRKIAYLGGKGPFSYNLQEVRSWLEKNFSKRUILD

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 31.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine). Essential for providing the brain with appropriate levels of T3 during the critical period of development.

Function : Catalyzes the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine). Essential for providing the brain with appropriate levels of T3 during the critical period of development.

Involvement in disease :

Subcellular location : Membrane, Single-pass membrane protein

Protein Families : Iodothyronine deiodinase family

Tissue Specificity : Expressed in cerebral cortex, cerebellum, pituitary gland, mostly in anterior pituitary gland, and pineal gland, as well as in brown adipose tissue (BAT).

Paythway :

Uniprot ID : P70551