Recombinant Rickettsia conorii Outer membrane protein A (ompA), partial

Product Description

Recombinant Rickettsia conorii Outer membrane protein A (ompA), partial is available at Gentaur for Next week Delivery.

Gene Name: ompA

Alternative Names : 190KDA antigen Cell surface antigen rOmp A

Expression Region : 1734-2021aa

AA Sequence : DMDAKFGAWISPFVGNATQKMCNSISGYKSDTTGGTIGFDGFVSDDLVLGLAYTRADTDIKLKNNKTGDKNKVESNIYSLYGLYSVPYENLFVEAIASYSDNKIRSKSRRVIATTLETVGYQTANGKYKSESYTGQLMAGYTYMMSENINLTPLAGLRYSTIKDKSYKETGTTYQNLTVKGKNYNTFDGLLGAKVSSNINVNEIVLTPELYAMVDYAFKNKVSAIDARLQGMTAPLPTNSFKQSKTSFDVGVGVTAKHKMMEYGINYDTNIGSKYFAQQGSVKVRVNF

Sequence Info : Partial

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 51.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Microbiology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Elicits protective immunity.

Function : Elicits protective immunity.

Involvement in disease :

Subcellular location : Outer membrane protein A: Periplasm, SUBCELLULAR LOCATION: 120 kDa surface-exposed protein: Secreted, Cell surface, Note=Surface exposed, This bacterium is covered by a S-layer with hexagonal symmetry, SUBCELLULAR LOCATION: 32 kDa beta peptide: Cell outer membrane, Multi-pass membrane protein

Protein Families : Rickettsiae OmpA/OmpB family

Tissue Specificity :

Paythway :

Uniprot ID : Q52657