Recombinant Saccharomyces cerevisiae Acyl-CoA-binding protein (ACB1)

Product Description

Recombinant Saccharomyces cerevisiae Acyl-CoA-binding protein (ACB1) is available at Gentaur for Next week Delivery.

Gene Name: ACB1

Alternative Names : Short name:ACBP

Expression Region : 1-87aa

AA Sequence : MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS

Sequence Info : Full Length

Tag Info : Tag-Free

Theoretical MW : 10.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.

Function : Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.

Involvement in disease :

Subcellular location :

Protein Families : ACBP family

Tissue Specificity :

Paythway :

Uniprot ID : P31787