Product Description
Recombinant Saccharomyces cerevisiae Acyl-CoA-binding protein (ACB1) is available at Gentaur for Next week Delivery.
Gene Name: ACB1
Alternative Names : Short name:ACBP
Expression Region : 1-87aa
AA Sequence : MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS
Sequence Info : Full Length
Tag Info : Tag-Free
Theoretical MW : 10.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.
Function : Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.
Involvement in disease :
Subcellular location :
Protein Families : ACBP family
Tissue Specificity :
Paythway :
Uniprot ID : P31787
Euro
British Pound
US Dollar