Recombinant Saccharomyces cerevisiae Ubiquitin-like-specific protease 1 (ULP1), partial

Product Description

Recombinant Saccharomyces cerevisiae Ubiquitin-like-specific protease 1 (ULP1), partial is available at Gentaur for Next week Delivery.

Gene Name: ULP1

Alternative Names :

Expression Region : 403-621aa

AA Sequence : LVPRGSHMASLVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDCGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 27.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SMT3 to its mature form and deconjugation of SMT3 from targeted proteins. Has an essential role in the G2/M phase of the cell cycle.

Function : Protease that catalyzes two essential functions in the SUMO pathway

Involvement in disease :

Subcellular location :

Protein Families : Peptidase C48 family

Tissue Specificity :

Paythway :

Uniprot ID : Q02724