Euro
British Pound
US Dollar
Product Description
Recombinant Scavenger Receptor Class D Member 1 (SCARD1) is available at Gentaur for Next week Delivery.
Gene Name: Scavenger Receptor Class D Member 1
Alternative Names : CD68; GP110; Macrosialin; Macrophage Antigen CD68
Expression Region : Ala27~Pro282 plus TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA
AA Sequence :
Sequence Info :
Tag Info : N-terminal His and GST Tag
Theoretical MW : 61.4kDa
Storage Buffer : PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Endotoxin Level : <1.0EU per 1ug (determined by the LAL method)-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal transduction; CD & Adhesion molecule; Infection immunity;
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P31996
