Product Description
Recombinant Sheep Beta-2-microglobulin (B2M) is available at Gentaur for Next week Delivery.
Gene Name: B2M
Alternative Names :
Expression Region : 21-118aa
AA Sequence : IQRIPEVQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVNHVTLTQPKIVKWDRDL
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 18.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system
Function : Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system (By similarity).
Involvement in disease :
Subcellular location : Secreted
Protein Families : Beta-2-microglobulin family
Tissue Specificity :
Paythway :
Uniprot ID : Q6QAT4
Euro
British Pound
US Dollar