Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase (acpS)

Product Description

Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase (acpS) is available at Gentaur for Next week Delivery.

Gene Name: acpS

Alternative Names : 4'-phosphopantetheinyl transferase AcpS

Expression Region : 1-119aa

AA Sequence : MIHGIGVDLIEIDRIKVLYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 29.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.

Function : Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : P-Pant transferase superfamily, AcpS family

Tissue Specificity :

Paythway :

Uniprot ID : Q6GF02