Recombinant Streptococcus pyogenes serotype M6 50S ribosomal protein L7/L12 (rplL)

Product Description

Recombinant Streptococcus pyogenes serotype M6 50S ribosomal protein L7/L12 (rplL) is available at Gentaur for Next week Delivery.

Gene Name: rplL

Alternative Names :

Expression Region : 1-121aa

AA Sequence : MALNIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAAAAAGGAEEAAKDSFDVELTSAGDKKVGVIKAVREITGLGLKEAKGLVDGAPANVKEGVAAAEAEEIKAKLEEAGATITLK

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 32.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation.

Function : Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation.

Involvement in disease :

Subcellular location :

Protein Families : Bacterial ribosomal protein bL12 family

Tissue Specificity :

Paythway :

Uniprot ID : Q5XCB4