Recombinant Streptomyces globisporus Lysozyme M1 (acm)

Product Description

Recombinant Streptomyces globisporus Lysozyme M1 (acm) is available at Gentaur for Next week Delivery.

Gene Name: acm

Alternative Names : 1,4-beta-N-acetylmuramidase M1

Expression Region : 78-294aa

AA Sequence : DTSGVQGIDVSHWQGSINWSSVKSAGMSFAYIKATEGTNYKDDRFSANYTNAYNAGIIRGAYHFARPNASSGTAQADYFASNGGGWSRDNRTLPGVLDIEHNPSGAMCYGLSTTQMRTWINDFHARYKARTTRDVVIYTTASWWNTCTGSWNGMAAKSPFWVAHWGVSAPTVPSGFPTWTFWQYSATGRVGGVSGDVDRNKFNGSAARLLALANNTA

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 30.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This enzyme has both lysozyme (acetylmuramidase) and diacetylmuramidase activities.

Function : This enzyme has both lysozyme (acetylmuramidase) and diacetylmuramidase activities.

Involvement in disease :

Subcellular location : Secreted, extracellular space

Protein Families : Glycosyl hydrolase 25 family

Tissue Specificity :

Paythway :

Uniprot ID : P25310