Recombinant Sulfolobus solfataricus DNA-binding protein 7d (sso7d)

Product Description

Recombinant Sulfolobus solfataricus DNA-binding protein 7d (sso7d) is available at Gentaur for Next week Delivery.

Gene Name: sso7d

Alternative Names : 7KDA DNA-binding protein dSso7d

Expression Region : 2-64aa

AA Sequence : ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 9.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Constrain negative DNA supercoils; may be involved in maintaining the integrity of their genome at high tperature. Stimulates the Holliday junction cleavage activity of Hjc.

Function : Can constrain negative DNA supercoils. May be involved in maintaining the integrity of the genome at high temperature (By similarity). Stimulates the Holliday junction cleavage activity of Hjc

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : 7 kDa DNA-binding/endoribonuclease P2 family

Tissue Specificity :

Paythway :

Uniprot ID : P39476