Product Description
Recombinant Sulfolobus solfataricus DNA-binding protein 7d (sso7d) is available at Gentaur for Next week Delivery.
Gene Name: sso7d
Alternative Names : 7KDA DNA-binding protein dSso7d
Expression Region : 2-64aa
AA Sequence : ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 9.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Constrain negative DNA supercoils; may be involved in maintaining the integrity of their genome at high tperature. Stimulates the Holliday junction cleavage activity of Hjc.
Function : Can constrain negative DNA supercoils. May be involved in maintaining the integrity of the genome at high temperature (By similarity). Stimulates the Holliday junction cleavage activity of Hjc
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : 7 kDa DNA-binding/endoribonuclease P2 family
Tissue Specificity :
Paythway :
Uniprot ID : P39476
Euro
British Pound
US Dollar