Product Description
Recombinant Trichoderma reesei Hydrophobin-2 (hfb2) is available at Gentaur for Next week Delivery.
Gene Name: hfb2
Alternative Names : Hydrophobin II
Expression Region : 16-86aa
AA Sequence : AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-sumostar-tagged
Theoretical MW : 23.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Responsible for spore hydrophobicity and protection.
Function : Responsible for spore hydrophobicity and protection.
Involvement in disease :
Subcellular location : Spore wall, Secreted, cell wall
Protein Families : Cerato-ulmin hydrophobin family
Tissue Specificity :
Paythway :
Uniprot ID : P79073