Product Description
Recombinant Triticum aestivum Granule-bound starch synthase 1,chloroplastic/amyloplastic (WAXY), partial is available at Gentaur for Next week Delivery.
Gene Name: WAXY
Alternative Names : Granule-bound starch synthase I Short name: GBSS-I
Expression Region : 79-349aa
AA Sequence : LVFVGAEMAPWSKTGGLGDVLGGLPAAMAANGHRVMVISPRYDQYKDAWDTSVISEIKVVDRYERVRYFHCYKRGVDRVFVDHPCFLEKVRGKTKEKIYGPDAGTDYEDNQQRFSLLCQAALEVPRILDLNNNPHFSGPYAMLCRAVPRRAGEDVVFVCNDWHTGLLACYLKSNYQSNGIYRTAKVAFCIHNISYQGRFSFDDFAQLNLPDRFKSSFDFIDGYDKPVEGRKINWMKAGILQADKVLTVSPYYAEELISGEARGCELDNIMR
Sequence Info : Partial
Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 35.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Plastid, chloroplast, Plastid, amyloplast
Protein Families : Glycosyltransferase 1 family, Bacterial/plant glycogen synthase subfamily
Tissue Specificity : Found in seeds and pollen.
Paythway :
Uniprot ID : P27736
Euro
British Pound
US Dollar