Recombinant Triticum aestivum Granule-bound starch synthase 1,chloroplastic/amyloplastic (WAXY), partial

Product Description

Recombinant Triticum aestivum Granule-bound starch synthase 1,chloroplastic/amyloplastic (WAXY), partial is available at Gentaur for Next week Delivery.

Gene Name: WAXY

Alternative Names : Granule-bound starch synthase I Short name: GBSS-I

Expression Region : 79-349aa

AA Sequence : LVFVGAEMAPWSKTGGLGDVLGGLPAAMAANGHRVMVISPRYDQYKDAWDTSVISEIKVVDRYERVRYFHCYKRGVDRVFVDHPCFLEKVRGKTKEKIYGPDAGTDYEDNQQRFSLLCQAALEVPRILDLNNNPHFSGPYAMLCRAVPRRAGEDVVFVCNDWHTGLLACYLKSNYQSNGIYRTAKVAFCIHNISYQGRFSFDDFAQLNLPDRFKSSFDFIDGYDKPVEGRKINWMKAGILQADKVLTVSPYYAEELISGEARGCELDNIMR

Sequence Info : Partial

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 35.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location : Plastid, chloroplast, Plastid, amyloplast

Protein Families : Glycosyltransferase 1 family, Bacterial/plant glycogen synthase subfamily

Tissue Specificity : Found in seeds and pollen.

Paythway :

Uniprot ID : P27736