Recombinant Truncated plaque-size/host range protein (PS/HR)

Product Description

Recombinant Truncated plaque-size/host range protein (PS/HR) is available at Gentaur for Next week Delivery.

Gene Name: PS/HR

Alternative Names : Protein B5

Expression Region : 18-92aa

AA Sequence : YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal MBP-tagged and C-terminal 6xHis-tagged

Theoretical MW : 52.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional.

Function : Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional.

Involvement in disease :

Subcellular location :

Protein Families : Receptors of complement activation (RCA) family

Tissue Specificity :

Paythway :

Uniprot ID : P24284