Euro
British Pound
US Dollar
Product Description
Recombinant Tuber borchii Cyanovirin-N homolog is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names :
Expression Region : 1-103aa
AA Sequence : MSYADSSRNAVLTNGGRTLRAECRNADGNWVTSELDLDTCIGNPNGFLGWGMQNFSHSSEDIKLEEGGRKLTCRPKTVDGGFRERQGIDLNRIQNVNGRLVFQ
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 15.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Mannose-binding lectin.
Function : Mannose-binding lectin.
Involvement in disease :
Subcellular location :
Protein Families : Cyanovirin-N family
Tissue Specificity :
Paythway :
Uniprot ID : Q5MK11
