Recombinant Vaccinia virus Complement control protein C3 (VACWR025)

Product Description

Recombinant Vaccinia virus Complement control protein C3 (VACWR025) is available at Gentaur for Next week Delivery.

Gene Name: VACWR025

Alternative Names : 28KDA protein Secretory protein 35 Short name: Protein C3 VCP

Expression Region : 20-263aa

AA Sequence : CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 28.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Microbiology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Serves to protect the virus against complement attack by inhibiting both classical and alternative pathways of complement activation. Binds C3b and C4b.

Function : Serves to protect the virus against complement attack by inhibiting both classical and alternative pathways of complement activation. Binds C3b and C4b.

Involvement in disease :

Subcellular location : Virion membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, Extracellular side, Secreted

Protein Families : Receptors of complement activation (RCA) family

Tissue Specificity :

Paythway :

Uniprot ID : P68638