Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR), partial

Product Description

Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR), partial is available at Gentaur for Next week Delivery.

Gene Name: PS/HR

Alternative Names : Protein B5

Expression Region : 18-279aa

AA Sequence : YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 33.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions to allow virion entry into host cells. Participates also in wrapping mature virions to form enveloped virions.

Function : Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EV) to allow virion entry into host cells. Participates also in wrapping mature virions (MV) to form enveloped virions (EV).

Involvement in disease :

Subcellular location : Virion membrane, Single-pass type I membrane protein, Virion

Protein Families : Receptors of complement activation (RCA) family

Tissue Specificity :

Paythway :

Uniprot ID : Q01227