Product Description
Recombinant Variola virus 14KDA fusion protein (A27L, A30L) is available at Gentaur for Next week Delivery.
Gene Name: A27L,A30L
Alternative Names :
Expression Region : 1-110aa
AA Sequence : MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Sequence Info : Full Length
Tag Info : N-terminal 10xHis-tagged
Theoretical MW : 15.0 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Microbiology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion (By similarity).
Function : Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion (By similarity).
Involvement in disease :
Subcellular location : Virion
Protein Families : Chordopoxvirinae A27 protein family
Tissue Specificity :
Paythway :
Uniprot ID : P33816
Euro
British Pound
US Dollar