Recombinant Variola virus 14KDA fusion protein (A27L, A30L)

Product Description

Recombinant Variola virus 14KDA fusion protein (A27L, A30L) is available at Gentaur for Next week Delivery.

Gene Name: A27L,A30L

Alternative Names :

Expression Region : 1-110aa

AA Sequence : MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged

Theoretical MW : 15.0 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Microbiology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion (By similarity).

Function : Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion (By similarity).

Involvement in disease :

Subcellular location : Virion

Protein Families : Chordopoxvirinae A27 protein family

Tissue Specificity :

Paythway :

Uniprot ID : P33816