Recombinant Vibrio parahaemolyticus serotype O3:K6 Outer membrane protein ompK (ompK)

Product Description

Recombinant Vibrio parahaemolyticus serotype O3:K6 Outer membrane protein ompK (ompK) is available at Gentaur for Next week Delivery.

Gene Name: ompK

Alternative Names :

Expression Region : 21-266aa

AA Sequence : ADYSDGDIHKNDYKWMQFNLMGAFDELPGESSHDYLEMEFGGRSGIFDLYGYVDVFNLASDKGSDKVGDPKIFMKFAPRMSIDGLTGKDLSFGPVQELYVATLFEWDGTDYKTNPFSVNNQKVGIGSDVMVPWFGKVGVNLYGTYQGNQKDWNGFQISTNWFKPFYFFENGSFISYQGYIDYQFGMKEKYSSASNGGAMFNGIYWHSDRFAVGYGLKGYKDVYGIKDSDALKSTGFGHYVAVTYKF

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 43.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Serves as receptor for a broad-host-range vibriophage, KVP40.

Function : Serves as receptor for a broad-host-range vibriophage, KVP40.

Involvement in disease :

Subcellular location : Cell outer membrane

Protein Families : Nucleoside-specific channel-forming outer membrane porin (Tsx) (TC 1.B.10) family

Tissue Specificity :

Paythway :

Uniprot ID : P59570