Recombinant Vicia faba Legumin type B (LEB6), partial

Product Description

Recombinant Vicia faba Legumin type B (LEB6), partial is available at Gentaur for Next week Delivery.

Gene Name: LEB6

Alternative Names : Legumin type B acidic chain

Expression Region : 1-148aa

AA Sequence : GIPYWTYNNGDEPLVAISLLDTSNIANQLDSTPRVFYLGGNPEVEFPETQEEQQERHQQKHSLPVGRRGGQHQQEEDGNSVLSGFSSEFLAQTFNTEEDTAKRLRSPRDKRNQIVRVEGGLRIINPEGQQEEEEEEEEEKQRSEQGRN

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 19 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This protein found in the seeds of many leguminous and non-leguminous plants is the source of sulfur-containing amino acids in seed meals.

Function : This protein found in the seeds of many leguminous and non-leguminous plants is the source of sulfur-containing amino acids in seed meals.

Involvement in disease :

Subcellular location :

Protein Families : 11S seed storage protein (globulins) family

Tissue Specificity :

Paythway :

Uniprot ID : P16079