Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail)

Product Description

Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail) is available at Gentaur for Next week Delivery.

Gene Name: ail

Alternative Names :

Expression Region : 24-178aa

AA Sequence : ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 33.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Promotes the invasion of pathogenic bacteria into eukaryotic cells by an unknown mechanism.

Function : Promotes the invasion of pathogenic bacteria into eukaryotic cells by an unknown mechanism.

Involvement in disease :

Subcellular location : Cell outer membrane, Multi-pass membrane protein

Protein Families : Ail/OmpX/PagC/Lom family

Tissue Specificity :

Paythway :

Uniprot ID : P16454