Product Description
Recombinant Yersinia enterocolitica Invasin, partial is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names :
Expression Region : 651-835aa
AA Sequence : VNGEQFATDKGFPKTTFNKATFQLVMNDDVANNTQYDWTSSYAASAPVDNQGKVNIAYKTYGSTVTVTAKSKKFPSYTATYQFKPNLWVFSGTMSLQSSVEASRNCQRTDFTALIESARASNGSRSPDGTLWGEWGSLATYDSAEWPSGNYWTKKTSTDFVTMDMTTGDIPTSAATAYPLCAEPQ
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 36.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Microbiology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Invasin is a protein that allows enteric bacteria to penetrate cultured mammalian cells. The entry of invasin in the cell is mediated by binding several beta-1 chain integrins.
Function : Invasin is a protein that allows enteric bacteria to penetrate cultured mammalian cells. The entry of invasin in the cell is mediated by binding several beta-1 chain integrins.
Involvement in disease :
Subcellular location : Cell outer membrane
Protein Families : Intimin/invasin family
Tissue Specificity :
Paythway :
Uniprot ID : P19196
Euro
British Pound
US Dollar