Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE (yopE)

Product Description

Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE (yopE) is available at Gentaur for Next week Delivery.

Gene Name: yopE

Alternative Names :

Expression Region : 1-219aa

AA Sequence : MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 38.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis

Function : Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis.

Involvement in disease :

Subcellular location : Cell outer membrane

Protein Families : YopE family

Tissue Specificity :

Paythway :

Uniprot ID : P31492