BVR Protein

Product Description

BVR Protein is available at Gentaur for Next week delivery.

Description:  Rat Natural BVR Full Length Protein

Alternative Name(s):  Biliverdin Reductase Protein, Biliverdin IX alpha reductase Protein, Biliverdin reductase A Protein, Biliverdin-IX alpha-reductase Protein, BLVR A Protein, BLVR Protein, Blvra Protein, BVR A Protein, BVRA Protein, Zinc metalloProtein, zinc-metalloprotein Protein

Research Area(s):  Cancer | Oxidative Stress

Nature:  Natural

Accession Number: NP_446302.1

Gene ID:  116599

Swiss-Prot:  P46844 

Applications Species:  WB | SDS-PAGE 

Biological Activity: 

Expression System: Native

Protein Length:  Full Length

Amino Acid Sequence: MDAEPKRKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLCHQKK

Purification:  Ion-exchange Purified

Storage Buffer:  10mM Tris pH7.5, 0.1mM EDTA, 0.2mM DTT, 20% glycerol

Concentration:  Lot/batch specific. See included datasheet.

Shipping Temperature: Blue Ice or 4ºC

Other relevant information:

Certificate of Analysis: This product has been certified >90% pure using SDS - PAGE analysis.  

Cellular Localization:  Cytoplasm

Scientific Background:  Biliverdin Reductase (BVR) is a cytoplasmic enzyme that catalyzes the conversion of biliverdin to bilirubin by converting a double bond between the second and third pyrrole ring into a single bond (1). It is ubiqutiously expressed in all tissues- it occurs in cells and brain regiuons that already display HO-1 and HO-2, but also in regions and cell types with potential to induce stress proteins. It is unique among all enzymes in having two pH optima, using a different cofactor at each pH range, NADH at pH7.0 and NADPH at pH8.7 (2). It is not inactivated by heat shock, and have shown to abate inflammation, oxidative stress and apoptosis (3).

References: 1. Singleton J.W., Laster L. (1965). J Biol Chem. 240: 4780-4789. 2. Kutty R.K., Maines M.D. (1981) J Biol Chem. 256: 3956-3962. 3. Mishra M., Ndisand J.F. (2014) Curr Pharm Des. 20(9): 1370-1391.

Field of Use:  Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

PubMed ID: 

Published Application: 

Published Species Reactivity: