Toggle menu
020 3393 8531
  • EUR
    • British Pound
    • Euro
    • US Dollar
    • LoginorSign Up
    • 0
    Orla Protein Technologies
    ×
    • EUR
      • British Pound
      • Euro
      • US Dollar
    ×

      Main Menu

    • Distributors
    • Shipping and Returns to Orla
    • Contact Us
    • Blog
      • OralSurf
      • boston biochem
      • Application of high-pressURE
      • Bone-resorption
      • Btf5
      • buffy coats
      • Cathepsin-d
      • cryopreservation of cells
      • Dissociation constant kd
      • Facs protocol
      • Foxp3 antibody
      • foxp3-staining-kit
      • gamma-delta-t-cells
      • Gp120-antibody
      • Growing artificial organs
      • Human-like collagen promotes the healing of acetic acid-induced gastric ulcers in rats by regulating NOS and growth factors
      • paraffin sections
      • Pas stain for fungus
      • Periodic acid schiff
      • Potential of plants to produce recombinant protein products
      • Rabbit Polyclonals
      • Staining antibodies protocol
      • U.S. Food and Drug Administration anticancer drug approval trends from 2016 to 2018 for lung, colorectal, breast, and prostate cancer
      • Vial
    • Shop By Category

    • 2019-nCoV Antibody
    • 2019-nCoV Protein
    • AccuCount
    • Allergen
    • Antibody
    • Antigen
    • Assay Developers
    • Assay Kit
    • Blocking Peptides
    • Cells
    • Clinical Laboratories
    • COVID-19
    • DNA
    • Elisa Kit
    • Elisa Kits
    • Extraction
    • Flow Cytometry
    • Gentaur Antibodies
    • Humanazied Antibody
    • Humanized monoclonal antibody
    • IBT Bioservices
    • Immuno-Histo Chemistry
    • Medium & Cell Culture
    • Oxidation
    • PCR Kit
    • Rabbit polyclonal
    • SAH Antibodies
    • SAM Antibodies
    • SD Bioline
    • Serum
    • Stem Cell Marker
    • Vector
    • Virus
    • Antibodies
    • Assay
    • Cell
    • Coronavirus
    • ExoQuick
    • Fluorescence
    • Gel
    • Lab
    • Magnetic Beads
    • Molecular Biology
    • NatTrol
    • OneqPCR RealTime
    • Oxiselect
    • PAB Polyconals
    • Panbio
    • Plasmid
    • qPCR
    • QuantiChrom
    • Rainbow
    • Reagent
    • Recombinant
    • Solution
    • SPHERO
    • Spoligotyping
    • Stain
    • Monoclonal
    • Protein
    • RNA Isolation
    • Dounce homogenizer
    • Antigen ELISA
    • Assay Tests
    • Branched DNA Assay
    • Recombinant Proteins
    • Select Currency: EUR
      • British Pound
      • Euro
      • US Dollar
    • Gift Certificates
    • Login or Sign Up
    ×

      Main Menu

    • Distributors
    • Shipping and Returns to Orla
    • Contact Us
    • Blog
      • OralSurf
      • boston biochem
      • Application of high-pressURE
      • Bone-resorption
      • Btf5
      • buffy coats
      • Cathepsin-d
      • cryopreservation of cells
      • Dissociation constant kd
      • Facs protocol
      • Foxp3 antibody
      • foxp3-staining-kit
      • gamma-delta-t-cells
      • Gp120-antibody
      • Growing artificial organs
      • Human-like collagen promotes the healing of acetic acid-induced gastric ulcers in rats by regulating NOS and growth factors
      • paraffin sections
      • Pas stain for fungus
      • Periodic acid schiff
      • Potential of plants to produce recombinant protein products
      • Rabbit Polyclonals
      • Staining antibodies protocol
      • U.S. Food and Drug Administration anticancer drug approval trends from 2016 to 2018 for lung, colorectal, breast, and prostate cancer
      • Vial
    • Shop By Category

    • 2019-nCoV Antibody
    • 2019-nCoV Protein
    • AccuCount
    • Allergen
    • Antibody
    • Antigen
    • Assay Developers
    • Assay Kit
    • Blocking Peptides
    • Cells
    • Clinical Laboratories
    • COVID-19
    • DNA
    • Elisa Kit
    • Elisa Kits
    • Extraction
    • Flow Cytometry
    • Gentaur Antibodies
    • Humanazied Antibody
    • Humanized monoclonal antibody
    • IBT Bioservices
    • Immuno-Histo Chemistry
    • Medium & Cell Culture
    • Oxidation
    • PCR Kit
    • Rabbit polyclonal
    • SAH Antibodies
    • SAM Antibodies
    • SD Bioline
    • Serum
    • Stem Cell Marker
    • Vector
    • Virus
    • Antibodies
    • Assay
    • Cell
    • Coronavirus
    • ExoQuick
    • Fluorescence
    • Gel
    • Lab
    • Magnetic Beads
    • Molecular Biology
    • NatTrol
    • OneqPCR RealTime
    • Oxiselect
    • PAB Polyconals
    • Panbio
    • Plasmid
    • qPCR
    • QuantiChrom
    • Rainbow
    • Reagent
    • Recombinant
    • Solution
    • SPHERO
    • Spoligotyping
    • Stain
    • Monoclonal
    • Protein
    • RNA Isolation
    • Dounce homogenizer
    • Antigen ELISA
    • Assay Tests
    • Branched DNA Assay
    • Recombinant Proteins
    • Select Currency: EUR
      • British Pound
      • Euro
      • US Dollar
    • Gift Certificates
    • Login or Sign Up

    Shop by Category

  • 2019-nCoV Antibody
  • 2019-nCoV Protein
  • AccuCount
  • Allergen
  • Antibody
  • Antigen
  • Assay Developers
  • Assay Kit
  • Blocking Peptides
  • Cells
  • Clinical Laboratories
  • COVID-19
  • DNA
  • Elisa Kit
  • Elisa Kits
  • Extraction
  • Flow Cytometry
  • Gentaur Antibodies
  • Humanazied Antibody
  • Humanized monoclonal antibody
  • IBT Bioservices
  • Immuno-Histo Chemistry
  • Medium & Cell Culture
  • Oxidation
  • PCR Kit
  • Rabbit polyclonal
  • SAH Antibodies
  • SAM Antibodies
  • SD Bioline
  • Serum
  • Stem Cell Marker
  • Vector
  • Virus
  • Antibodies
  • Assay
  • Cell
  • Coronavirus
  • ExoQuick
  • Fluorescence
  • Gel
  • Lab
  • Magnetic Beads
  • Molecular Biology
  • NatTrol
  • OneqPCR RealTime
  • Oxiselect
  • PAB Polyconals
  • Panbio
  • Plasmid
  • qPCR
  • QuantiChrom
  • Rainbow
  • Reagent
  • Recombinant
  • Solution
  • SPHERO
  • Spoligotyping
  • Stain
  • Monoclonal
  • Protein
  • RNA Isolation
  • Dounce homogenizer
  • Antigen ELISA
  • Assay Tests
  • Branched DNA Assay
  • Recombinant Proteins
  • Shop by Brand

  • Nova Tech
  • Biomatik Proteins
  • Fine Test
  • MBS
  • Life Science M
  • Mybiosource
  • Gentaur
  • Fine Test Ltd
  • Nova Life
  • Bioscience
  • View all Brands
    • Home
    • Protein
    • BVR Protein
  • BVR Protein
  • BVR Protein
  • BVR Protein
  • BVR Protein BVR Protein BVR Protein

    BVR Protein

    Stress Marq Biosciences

    MSRP:
    Now: €129,400.00
    (You save )
    (No reviews yet) Write a Review
    SKU:
    SPR-320C
    Availability:
    Next week
    Shipping:
    Calculated at Checkout
    Size:
    2x100 µg
    Species:
    Rat
    Specificity:
    ~36 kDa
    Conjugate:
    No tag
    Storage Temperature:
    -80ºC
    Purity:
    >90%

    Adding to cart… category.add_cart_announcement
    Add to Wish List
    • Create New Wish List
    • Facebook
    • Email
    • Print
    • Twitter
    • Pinterest
    • Overview
    • Reviews

    Product Description

    BVR Protein is available at Gentaur for Next week delivery.

    Description:  Rat Natural BVR Full Length Protein

    Alternative Name(s):  Biliverdin Reductase Protein, Biliverdin IX alpha reductase Protein, Biliverdin reductase A Protein, Biliverdin-IX alpha-reductase Protein, BLVR A Protein, BLVR Protein, Blvra Protein, BVR A Protein, BVRA Protein, Zinc metalloProtein, zinc-metalloprotein Protein

    Research Area(s):  Cancer | Oxidative Stress

    Nature:  Natural

    Accession Number: NP_446302.1

    Gene ID:  116599

    Swiss-Prot:  P46844 

    Applications Species:  WB | SDS-PAGE 

    Biological Activity: 

    Expression System: Native

    Protein Length:  Full Length

    Amino Acid Sequence: MDAEPKRKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLCHQKK

    Purification:  Ion-exchange Purified

    Storage Buffer:  10mM Tris pH7.5, 0.1mM EDTA, 0.2mM DTT, 20% glycerol

    Concentration:  Lot/batch specific. See included datasheet.

    Shipping Temperature: Blue Ice or 4ºC

    Other relevant information:

    Certificate of Analysis: This product has been certified >90% pure using SDS - PAGE analysis.  

    Cellular Localization:  Cytoplasm

    Scientific Background:  Biliverdin Reductase (BVR) is a cytoplasmic enzyme that catalyzes the conversion of biliverdin to bilirubin by converting a double bond between the second and third pyrrole ring into a single bond (1). It is ubiqutiously expressed in all tissues- it occurs in cells and brain regiuons that already display HO-1 and HO-2, but also in regions and cell types with potential to induce stress proteins. It is unique among all enzymes in having two pH optima, using a different cofactor at each pH range, NADH at pH7.0 and NADPH at pH8.7 (2). It is not inactivated by heat shock, and have shown to abate inflammation, oxidative stress and apoptosis (3).

    References: 1. Singleton J.W., Laster L. (1965). J Biol Chem. 240: 4780-4789. 2. Kutty R.K., Maines M.D. (1981) J Biol Chem. 256: 3956-3962. 3. Mishra M., Ndisand J.F. (2014) Curr Pharm Des. 20(9): 1370-1391.

    Field of Use:  Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

    PubMed ID: 

    Published Application: 

    Published Species Reactivity: 

    "

    Product Videos

    Custom Field

    Size 2x100 µg
    Species Rat
    Specificity ~36 kDa
    Conjugate No tag
    Storage Temperature -80ºC
    Purity >90%

    Product Reviews

    Write a Review

    Write a Review

    ×
    BVR Protein
    Stress Marq Biosciences
    BVR Protein

    You May Also Like...

    • pShuttle-LacZ control vector pShuttle-LacZ control vector
      Quick view Details

      Smart Science

      |

      sku: A004

      pShuttle-LacZ control vector

      MSRP:
      Now: €1,175.00
      Add to Cart
    • pShuttle(-) Vector pShuttle(-) Vector
      Quick view Details

      Smart Science

      |

      sku: A003

      pShuttle(-) Vector

      MSRP:
      Now: €575.00
      Add to Cart
    • pShuttle(+) Vector pShuttle(+) Vector
      Quick view Details

      Smart Science

      |

      sku: A002

      pShuttle(+) Vector

      MSRP:
      Now: €575.00
      Add to Cart
    • Ready-to-Use Adeno DNA (Pre-linearized by I-Ceul/PI-SceI) Ready-to-Use Adeno DNA (Pre-linearized by I-Ceul/PI-SceI)
      Quick view Details

      Smart Science

      |

      sku: A001

      Ready-to-Use Adeno DNA (Pre-linearized by I-Ceul/PI-SceI)

      MSRP:
      Now: €6,875.00
      Add to Cart
    • TTR Protein TTR Protein
      Quick view Details

      Stress Marq Biosciences

      |

      sku: SPR-465E

      TTR Protein

      MSRP:
      Now: €141,000.00
      Add to Cart
    • SOD Protein SOD Protein
      Quick view Details

      Stress Marq Biosciences

      |

      sku: SPR-470E

      SOD Protein

      MSRP:
      Now: €141,000.00
      Add to Cart
    • Gamma Synuclein Protein Gamma Synuclein Protein
      Quick view Details

      Stress Marq Biosciences

      |

      sku: SPR-460E

      Gamma Synuclein Protein

      MSRP:
      Now: €154,200.00
      Add to Cart
    • Beta Synuclein Protein Beta Synuclein Protein
      Quick view Details

      Stress Marq Biosciences

      |

      sku: SPR-457E

      Beta Synuclein Protein

      MSRP:
      Now: €117,700.00
      Add to Cart
    • Tau Protein Tau Protein
      Quick view Details

      Stress Marq Biosciences

      |

      sku: SPR-480E

      Tau Protein

      MSRP:
      Now: €148,000.00
      Add to Cart
    • Tissue Tek O.C.T. Compound Tissue Tek O.C.T. Compound
      Quick view Details

      Genprice Inc.

      |

      sku: 94-4583

      Tissue Tek O.C.T. Compound

      MSRP:
      Now: €345.00
      Add to Cart
    • Tissue-Tek Cryomold Intermediate 1 Tissue-Tek Cryomold Intermediate 1
      Quick view Details

      Genprice Inc.

      |

      sku: 94-4566

      Tissue-Tek Cryomold Intermediate 1

      MSRP:
      Now: €234.00
      Add to Cart
    • Tissue-Tek Cryomold Biopsy 10x10x5 Tissue-Tek Cryomold Biopsy 10x10x5
      Quick view Details

      Genprice Inc.

      |

      sku: 94-4565

      Tissue-Tek Cryomold Biopsy 10x10x5

      MSRP:
      Now: €147.00
      Add to Cart

    Recommended

    • ACTH protein ACTH protein
      Quick view Details

      Genprice

      |

      sku: 544-MBS5304071-2MG

      ACTH protein

      MSRP:
      Now: €480.00
      Add to Cart
    • BCA Protein BCA Protein
      Quick view Details

      Mybiosource

      |

      sku: MBS1752877

      BCA Protein

      MSRP:
      Now: €520.00
      Add to Cart
    • Total Protein Total Protein
      Quick view Details

      Mybiosource

      |

      sku: MBS2563959

      Total Protein

      MSRP:
      Now: €290.00
      Add to Cart
    • BLVRA (Biliverdin Reductase A, BVR A, Biliverdin-IX alpha-reductase, BLVR, BVR) BLVRA (Biliverdin Reductase A, BVR A, Biliverdin-IX alpha-reductase, BLVR, BVR)
      Quick view Details

      Mybiosource

      |

      sku: MBS6010990

      BLVRA (Biliverdin Reductase A, BVR A, Biliverdin-IX alpha-reductase, BLVR, BVR)

      MSRP:
      Now: €635.00
      Add to Cart
    • p23 Protein p23 Protein
      Quick view Details

      Stress Marq Biosciences

      |

      sku: SPR-303C

      p23 Protein

      MSRP:
      Now: €570.00
      Add to Cart
    ×
    ×
    Join Our Mailing List for special offers!
    Contact Us
    Unicorn House, Station Cl
    Hertfordshire, Potters Bar EN6 1TL
    Whetstone London N20 9BH
    Accounts & Orders
    • Wishlist
    • Login or Sign Up
    • Shipping & Returns
    Quick Links
    • Distributors
    • Shipping and Returns to Orla
    • Contact Us
    • Blog
    Recent Blog Posts
    • Single Domain Antibodies: Therapeutic Tools for the Future?
    • Macs Beads
    • SMAD7
    • New insights into Sauropsid Papillomaviridae evolution and epizootiology: discovery of two novel papillomaviruses in native and invasive Island geckos
    Connect with Us:
    • © Orla Protein Technologies
    • |
    • Sitemap