Product Description
BVR Protein is available at Gentaur for Next week delivery.
Description: Rat Natural BVR Full Length Protein
Alternative Name(s): Biliverdin Reductase Protein, Biliverdin IX alpha reductase Protein, Biliverdin reductase A Protein, Biliverdin-IX alpha-reductase Protein, BLVR A Protein, BLVR Protein, Blvra Protein, BVR A Protein, BVRA Protein, Zinc metalloProtein, zinc-metalloprotein Protein
Research Area(s): Cancer | Oxidative Stress
Nature: Natural
Accession Number: NP_446302.1
Gene ID: 116599
Swiss-Prot: P46844
Applications Species: WB | SDS-PAGE
Biological Activity:
Expression System: Native
Protein Length: Full Length
Amino Acid Sequence: MDAEPKRKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLCHQKK
Purification: Ion-exchange Purified
Storage Buffer: 10mM Tris pH7.5, 0.1mM EDTA, 0.2mM DTT, 20% glycerol
Concentration: Lot/batch specific. See included datasheet.
Shipping Temperature: Blue Ice or 4ºC
Other relevant information:
Certificate of Analysis: This product has been certified >90% pure using SDS - PAGE analysis.
Cellular Localization: Cytoplasm
Scientific Background: Biliverdin Reductase (BVR) is a cytoplasmic enzyme that catalyzes the conversion of biliverdin to bilirubin by converting a double bond between the second and third pyrrole ring into a single bond (1). It is ubiqutiously expressed in all tissues- it occurs in cells and brain regiuons that already display HO-1 and HO-2, but also in regions and cell types with potential to induce stress proteins. It is unique among all enzymes in having two pH optima, using a different cofactor at each pH range, NADH at pH7.0 and NADPH at pH8.7 (2). It is not inactivated by heat shock, and have shown to abate inflammation, oxidative stress and apoptosis (3).
References: 1. Singleton J.W., Laster L. (1965). J Biol Chem. 240: 4780-4789. 2. Kutty R.K., Maines M.D. (1981) J Biol Chem. 256: 3956-3962. 3. Mishra M., Ndisand J.F. (2014) Curr Pharm Des. 20(9): 1370-1391.
Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
PubMed ID:
Published Application:
Published Species Reactivity:
"
Euro
British Pound
US Dollar