Product Description
Cpn10 Protein is available at Gentaur for Next week delivery.
Description: Human Recombinant Cpn10 Protein
Alternative Name(s): 10kDa Chaperonin Protein, Chaperonin 10 Protein, Cpn 10 Protein, EPF Protein, GROES Protein, Heat Shock 10kD protein1 Protein, HSP10 Protein, HSPE1 Protein
Research Area(s): Cancer | Heat Shock
Nature: Recombinant
Accession Number: NM_002157.2
Gene ID: 3336
Swiss-Prot: P61604
Applications Species: WB | SDS-PAGE
Biological Activity:
Expression System: E. coli
Protein Length:
Amino Acid Sequence: MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Purification: Multi-Step Purified
Storage Buffer: 20mM Tris, pH7.5, 0.3M NaCl, 10% glycerol, 1 mM DTT
Concentration: Lot/batch specific. See included datasheet.
Shipping Temperature: Blue Ice or 4ÂșC
Other relevant information:
Certificate of Analysis: This product has been certified >90% pure using SDS-PAGE analysis.
Cellular Localization: Mitochondrion Matrix
Scientific Background: Chaperonin 10, otherwise known as Cpn10, (groES in E.coli) make up a family of small heart shock proteins with an approximate molecular mass of 10kDa (HSP10s). Cpn10 acts as a co-chaperone and interacts with the HSP60 family to promote proper folding of polypeptides. Cpn10 and Cpn60 both exhibit sevenfold axis of symmetry and function as a team in the protein folding and assembly process (1). Cpn10 has been located in human platelets, but is also present in human maternal serum (2, 3). It has been reported that human Cpn10 is identical with early pregnancy factor, which is involved in control over cell growth and development. This identification suggest that Cpn10 may act like a hormone in stressful situations such as pregnancy (4).
References: 1. Velez-Granell C.S., et al. (1994) J of Cell Science. 107(3):539-549. 2. Morton H., Hegh V., and Clunie G.J.A. (1974) Nature (London) 249: 459-460. 3. Cavanagh A.C., and Morton H. (1994) Eur. J. Biochem. 222: 551-560. 4. Minto M., et al. (1998) Molecular Cell Research. 1403 (2): 151-157.
Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
PubMed ID: 23775284
Published Application: Functional Assay
Published Species Reactivity: Human
"
Euro
British Pound
US Dollar