Recombinant Bordetella pertussis Pertactin autotransporter (prn), partial

Product Description

Recombinant Bordetella pertussis Pertactin autotransporter (prn), partial is available at Gentaur for Next week Delivery.

Gene Name: prn

Alternative Names : P.93

Expression Region : 632-910aa

AA Sequence : ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTRGDRGFTGDGGGHTDSVHVGGYATYIADSGFYLDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAGRRFTHADGWFLEPQAELAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKASVLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 45.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Agglutinogen that binds to eukaryotic cells; a process mediated by the R-G-D sequence. Pertactin may have a role in bacterial adhesion, and thus play a role in virulence. May contribute to the disease state of whooping cough.

Function : Agglutinogen that binds to eukaryotic cells; a process mediated by the R-G-D sequence. Pertactin may have a role in bacterial adhesion, and thus play a role in virulence. May contribute to the disease state of whooping cough.

Involvement in disease :

Subcellular location : Pertactin autotransporter: Periplasm, SUBCELLULAR LOCATION: Outer membrane protein P69: Secreted, Cell surface, SUBCELLULAR LOCATION: Pertactin translocator: Cell outer membrane, Multi-pass membrane protein

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P14283