Product Description
Recombinant Hafnia alvei Intimin (eaeA) is available at Gentaur for Next week Delivery.
Gene Name: eaeA
Alternative Names : Attaching and effacing protein Outer membrane protein
Expression Region : 1-280aa
AA Sequence : ITEIKADKTTAVANGKDAVTYTVKVMKDGKPLSGEEVTFTTTLGTLSKSTEKTNTNGYRKVSLTSANQGKSLVSASVTMPQLMLKLLEVEFFTQLTIDNGNVEIVGTGAKGKLPNVWLQYGQVNLKANGGNGKYTWYSANPAIASVDPSSGQVTLKDKGETTITVVSGDKQTAIYTIAMPNSIVSVNSSGRVDYNTANNICKNIKGSLPSSIKELKDLYDDWGAANKYQHYSQESITAWTLQTSENKVQGVASTYDLVRKNPLIDKVDIAGNYAYAVCVK
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 46.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Microbiology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Necessary for the production of attaching and effacing lesions on tissue culture cells.
Function : Necessary for the production of attaching and effacing lesions on tissue culture cells.
Involvement in disease :
Subcellular location : Cell outer membrane, Single-pass membrane protein
Protein Families : Intimin/invasin family
Tissue Specificity :
Paythway :
Uniprot ID : P52869