Recombinant Human Neurotensin/neuromedin N (NTS), partial

Product Description

Recombinant Human Neurotensin/neuromedin N (NTS), partial is available at Gentaur for Next week Delivery.

Gene Name: NTS

Alternative Names : NmN-125Neuromedin N;NN;NmNNeurotensin;NTTail peptide

Expression Region : 24-143aa

AA Sequence : SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRK

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 29.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.

Function : Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.

Involvement in disease :

Subcellular location : Secreted, Cytoplasmic vesicle, secretory vesicle

Protein Families : Neurotensin family

Tissue Specificity :

Paythway :

Uniprot ID : P30990