Product Description
Recombinant Human Neurotensin/neuromedin N (NTS), partial is available at Gentaur for Next week Delivery.
Gene Name: NTS
Alternative Names : NmN-125Neuromedin N;NN;NmNNeurotensin;NTTail peptide
Expression Region : 24-143aa
AA Sequence : SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRK
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 29.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
Function : Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
Involvement in disease :
Subcellular location : Secreted, Cytoplasmic vesicle, secretory vesicle
Protein Families : Neurotensin family
Tissue Specificity :
Paythway :
Uniprot ID : P30990
Euro
British Pound
US Dollar