Product Description
Recombinant Human Protein phosphatase 1 regulatory subunit 11 (PPP1R11) is available at Gentaur for Next week Delivery.
Gene Name: PPP1R11
Alternative Names : Hemochromatosis candidate gene V protein;HCG VProtein phosphatase inhibitor 3
Expression Region : 1-126aa
AA Sequence : MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 41 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Inhibitor of protein phosphatase 1.
Function : Atypical E3 ubiquitin-protein ligase which ubiquitinates TLR2 at 'Lys-754' leading to its degradation by the proteasome. Plays a role in regulating inflammatory cytokine release and gram-positive bacterial clearance by functioning, in part, through the ubiquitination and degradation of TLR2
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity : Widely expressed.
Paythway :
Uniprot ID : O60927
Euro
British Pound
US Dollar