Recombinant Human Protein phosphatase 1 regulatory subunit 11 (PPP1R11)

Product Description

Recombinant Human Protein phosphatase 1 regulatory subunit 11 (PPP1R11) is available at Gentaur for Next week Delivery.

Gene Name: PPP1R11

Alternative Names : Hemochromatosis candidate gene V protein;HCG VProtein phosphatase inhibitor 3

Expression Region : 1-126aa

AA Sequence : MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 41 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Inhibitor of protein phosphatase 1.

Function : Atypical E3 ubiquitin-protein ligase which ubiquitinates TLR2 at 'Lys-754' leading to its degradation by the proteasome. Plays a role in regulating inflammatory cytokine release and gram-positive bacterial clearance by functioning, in part, through the ubiquitination and degradation of TLR2

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity : Widely expressed.

Paythway :

Uniprot ID : O60927