Recombinant Human Renin receptor (ATP6AP2)

Product Description

Recombinant Human Renin receptor (ATP6AP2) is available at Gentaur for Next week Delivery.

Gene Name: ATP6AP2

Alternative Names : ATPase H(+)-transporting lysosomal accessory protein 2 ATPase H(+)-transporting lysosomal-interacting protein 2 ER-localized type I transmembrane adaptor Embryonic liver differentiation factor 10 N14F Renin/prorenin receptor Vacuolar ATP synthase membrane sector-associated protein M8-9

Expression Region : 17-350aa

AA Sequence : NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-tagged

Theoretical MW : 40 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Functions as a renin and prorenin cellular receptor. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS).

Function : Functions as a renin and prorenin cellular receptor. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS).

Involvement in disease : Mental retardation, X-linked, with epilepsy (MRXE); Parkinsonism with spasticity, X-linked (XPDS)

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity : Expressed in brain, heart, placenta, liver, kidney and pancreas. Barely detectable in lung and skeletal muscles. In the kidney cortex it is restricted to the mesangium of glomeruli. In the coronary and kidney artery it is expressed in the subendothelium, associated to smooth muscles where it colocalizes with REN. Expressed in vascular structures and by syncytiotrophoblast cells in the mature fetal placenta.

Paythway : Renin-angiotensinsystem

Uniprot ID : O75787