Recombinant Human Type-2 angiotensin II receptor (AGTR2), partial

Product Description

Recombinant Human Type-2 angiotensin II receptor (AGTR2), partial is available at Gentaur for Next week Delivery.

Gene Name: AGTR2

Alternative Names : Angiotensin II type-2 receptor Short name:AT2

Expression Region : 1-45aa

AA Sequence : MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 20.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation.

Function : Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : G-protein coupled receptor 1 family

Tissue Specificity : In adult, highly expressed in myometrium with lower levels in adrenal gland and fallopian tube. Expressed in the cerebellum. Very highly expressed in fetal kidney and intestine.

Paythway : Renin-angiotensinsystem

Uniprot ID : P50052