Euro
British Pound
US Dollar
Product Description
Recombinant Lake Victoria marburgvirus Matrix protein VP40 (VP40) is available at Gentaur for Next week Delivery.
Gene Name: VP40
Alternative Names : Membrane-associated protein VP40
Expression Region : 1-303aa
AA Sequence : MASSSNYNTYMQYLNPPPYADHGANQLIPADQLSNQQGITPNYVGDLNLDDQFKGNVCHAFTLEAIIDISAYNERTVKGVPAWLPLGIMSNFEYPLAHTVAALLTGSYTITQFTHNGQKFVRVNRLGTGIPAHPLRMLREGNQAFIQNMVIPRNFSTNQFTYNLTNLVLSVQKLPDDAWRPSKDKLIGNTMHPAVSVHPNLPPIVLPTVKKQAYRQHKNPNNGPLLAISGILHQLRVEKVPEKTSLFRISLPADMFSVKEGMMKKRGENSPVVYFQAPENFPLNGFNNRQVVLAYANPTLSAV
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 49.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Promotes virus assbly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma mbrane. Specific interactions with mbrane-associated GP and VP24 during the budding process may also occur. May play a role in genome replication .
Function : Promotes virus assembly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma membrane. Specific interactions with membrane-associated GP and VP24 during the budding process may also occur. May play a role in genome replication (By similarity).
Involvement in disease :
Subcellular location : Virion membrane, Peripheral membrane protein, Host late endosome membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, Cytoplasmic side, Host endomembrane system, Peripheral membrane protein
Protein Families : Filoviridae matrix protein VP40 family
Tissue Specificity :
Paythway :
Uniprot ID : Q1PD51
