Product Description
Recombinant Mouse Beta-synuclein (Sncb) is available at Gentaur for Next week Delivery.
Gene Name: Sncb
Alternative Names :
Expression Region : 1-133aa
AA Sequence : MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTSGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEA
Sequence Info : Full Length
Tag Info : Tag-Free
Theoretical MW : 14.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May be involved in neuronal plasticity.
Function : May be involved in neuronal plasticity.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Synuclein family
Tissue Specificity : Highly expressed in the brain.
Paythway :
Uniprot ID : Q91ZZ3
Euro
British Pound
US Dollar