Product Description
Recombinant Mouse Cerebellin-3 (Cbln3) is available at Gentaur for Next week Delivery.
Gene Name: Cbln3
Alternative Names :
Expression Region : 25-197aa
AA Sequence : QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 34.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May be involved in synaptic functions in the CNS.
Function : May be involved in synaptic functions in the CNS.
Involvement in disease :
Subcellular location : Endoplasmic reticulum, Golgi apparatus, cis-Golgi network, Secreted, Cell junction, synapse
Protein Families :
Tissue Specificity : Expressed in brain, restricted to the cerebellar cortex. Within the cerebellum, expressed in granule layers (at protein level). Also detected in postsynaptic Purkinje cell spines (at protein level).
Paythway :
Uniprot ID : Q9JHG0
Euro
British Pound
US Dollar